PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009770258.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 260aa    MW: 30410.8 Da    PI: 8.3455
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009770258.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-18449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+++G+++W++Ia+ ++ gR++k+c++rw++ 
   XP_009770258.1  4 RGHWRPHEDEKLRELVAKYGPHNWNAIAENLQ-GRSGKSCRLRWYNQ 49
                     899*****************************.************96 PP

2Myb_DNA-binding54.33e-175699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r ++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
   XP_009770258.1 56 RSPFTEEEEERLLASHRIHGNR-WAIIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.281154IPR017930Myb domain
SMARTSM007171.3E-16352IPR001005SANT/Myb domain
SuperFamilySSF466891.76E-29497IPR009057Homeodomain-like
PfamPF002491.0E-17450IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-27557IPR009057Homeodomain-like
CDDcd001671.36E-14748No hitNo description
SMARTSM007172.4E-1555103IPR001005SANT/Myb domain
PROSITE profilePS5129421.5555105IPR017930Myb domain
PfamPF002494.9E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-2158104IPR009057Homeodomain-like
CDDcd001674.19E-115898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MCSRGHWRPH EDEKLRELVA KYGPHNWNAI AENLQGRSGK SCRLRWYNQL DPRINRSPFT  60
EEEEERLLAS HRIHGNRWAI IARLFPGRTD NAVKNHWHVI MSRRCRERSK IYSLRNITAA  120
PKSTSQQDMS TTSPSDLQDD NNIHDIMRKR SSNISIDHHQ QLLERFNYYP FTNNNSLYPK  180
ELHFNHLPAQ RLKMDEGKNE AVECYDFLRV NTGSNKSEVV ENNIIRRDAE EVEQEAGDNN  240
SLQSKAPVRF IDFLSVGDSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-3441057108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-72HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBankHG9755151e-72HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009770258.10.0PREDICTED: transcriptional activator Myb-like
RefseqXP_016446234.10.0PREDICTED: transcriptional activator Myb-like
TrEMBLM1D2B81e-116M1D2B8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000797141e-115(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.13e-82myb domain protein 52